PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_23382-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 300aa    MW: 32649.2 Da    PI: 8.1483
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_23382-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-1785128146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T++E++l++d++ ++G++ W++Ia++++ gRt++++k++w++
  TRIUR3_23382-P1  85 RGNFTADEQLLILDLHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 128
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.0644579IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.9E-76082IPR009057Homeodomain-like
SuperFamilySSF466892.51E-2265139IPR009057Homeodomain-like
PROSITE profilePS5129423.8680134IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-2483133IPR009057Homeodomain-like
SMARTSM007171.2E-1584132IPR001005SANT/Myb domain
PfamPF002494.4E-1685128IPR001005SANT/Myb domain
CDDcd001672.50E-1287128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MGSLAASFAG RRPTCARFAV REETGAAREA RGSGRRRAVG DLCGWKAYSE VGTDRGSLAR  60
AAGLRRTGKS CRLRWLNYLR PDVKRGNFTA DEQLLILDLH SRWGNRWSKI AQHLPGRTDN  120
EIKNYWRTRV QKHAKQLNCD VGSATFKDAM REARGSPGSP RPAEPTPAAA GDPTIGDTSC  180
ASGVTSMATT AATATTYPEN NSPASAVTTS RSASSGSFTS ELCGEEKNLH VHGSGEKTTS  240
GGDWMQEADQ EFWAMHMQIQ PEDGGLFHVD HELSGWVQGF SDVGVSADNL WSLEDIWKMQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-17461261797MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-17461261797C-Myb DNA-Binding Domain
1msf_C3e-17461261797C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0090180.0BT009018.1 Triticum aestivum clone wdk3c.pk006.n12:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618000.12e-86PREDICTED: transcription factor MYB108
TrEMBLM7ZNL60.0M7ZNL6_TRIUA; Transcription factor MYB21
STRINGLOC_Os11g45740.15e-86(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.15e-46myb domain protein 112